SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003988661.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003988661.1.62641
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-47
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 243-286
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000419
Family SOCS box-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003988661.1.62641
Sequence length 288
Comment PREDICTED: ankyrin repeat and SOCS box protein 8 isoform X1 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVI
NLKGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVARDQQLCEKL
TVLCSAPGTLKTLSRYAVRRSLGLQYLPDAVKGLPLPASLKEYLLLVE
Download sequence
Identical sequences D2HE78 E2QST3 G1PXK4 H0WS78 L5MDA6 M3WJW9
ENSCAFP00000013266 ENSCAFP00000013266 ENSCHOP00000007762 ENSAMEP00000014650 ENSFCAP00000012987 ENSAMEP00000014650 ENSOGAP00000004928 ENSCHOP00000007762 XP_002920351.1.58354 XP_003988661.1.62641 XP_004396011.1.74151 XP_005636966.1.84170 XP_005636967.1.84170 XP_005636968.1.84170 XP_005636969.1.84170 XP_005636970.1.84170 XP_005636971.1.84170 XP_005636972.1.84170 XP_005877432.1.60319 XP_006091549.1.53796 XP_006091550.1.53796 XP_006755554.1.95426 XP_006755555.1.95426 XP_006933714.1.62641 XP_007073007.1.5354 XP_007073008.1.5354 XP_008586114.1.73410 XP_008702730.1.72690 XP_008702731.1.72690 XP_011224619.1.58354 XP_011224620.1.58354 XP_012416308.1.74151 XP_012662973.1.62490 XP_013963880.1.84170 XP_014404125.1.60319 XP_014921304.1.86478 XP_014921305.1.86478 XP_019274727.1.44245 XP_019274728.1.44245 XP_019481394.1.44202 XP_019481395.1.44202 XP_019656367.1.58354 XP_019690419.1.62641 XP_543713.2.84170 XP_863398.1.84170 ENSFCAP00000012987 ENSMLUP00000016181 ENSMLUP00000016181 9615.ENSCAFP00000013266 9685.ENSFCAP00000012987 ENSOGAP00000004928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]