SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003989750.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003989750.1.62641
Domain Number - Region: 112-172
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0377
Family Cytochrome c3-like 0.082
Further Details:      
 
Domain Number - Region: 13-19
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0968
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003989750.1.62641
Sequence length 208
Comment PREDICTED: transmembrane protein 222 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MAEAEGSSPLLLPPPPPPPGMAEVEVPTAAETDKKQFSGSGSSAMDVDRSRFPYCVVWTP
IPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVSEDNMAFGKPAKYWKLDPAQVYASGPNA
WDTAVHDASEEYKHRMHSLCCDNCHSHVALALNLMRYNNSTNWNMVTLCFFCLLYGKYVS
VGAFVKTWLPFVLLLGIILTVSLVFNLR
Download sequence
Identical sequences M3XBR4
XP_003989750.1.62641 ENSFCAP00000024068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]