SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003993267.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003993267.1.62641
Domain Number 1 Region: 346-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-86
Family Eukaryotic proteases 0.00000000119
Further Details:      
 
Domain Number 2 Region: 106-197
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-32
Family Kringle modules 0.00000729
Further Details:      
 
Domain Number 3 Region: 211-296
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-27
Family Kringle modules 0.0000176
Further Details:      
 
Domain Number 4 Region: 45-104
Classification Level Classification E-value
Superfamily GLA-domain 9.08e-19
Family GLA-domain 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003993267.1.62641
Sequence length 622
Comment PREDICTED: prothrombin [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MAHIRGLWLPGCLALAALCSLVHSQHVFLAPQQALSLLQRVRRANSGFLEEVRKGNLERE
CVEELCSYEEAFEALESSFATDVFWAKYTACESVRKPRDKLMECLEGNCAEGLGMNYRGN
VNFTRSGIECQLWRSRYPHKPEINYTTHPGADLKENFCRNPDGSTTGPWCYTTDPTVRRE
ECSIPICGQGGVTVQPTPRSRNSTVNLPPPSDSCIPERGRYYHGRLAVTTHGSPCLAWDS
SQAKALSENQDFNPLVPLEKNFCRNPDGDEEGVWCYVSGGPGDFEYCNLDYCEEPFEDVS
DGLAEDPEAPIEGRTTAEEFQTFFNEKTFGAGEADCGLRPLFEKKSLKDKTEEELLDSYI
DGRIVKGWDAEIGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERSIEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPIAFSSYIHP
VCLPDKATVARLIQTGYKGRVTGWGNLKETWTTSVGEVQPSVLQVVNLPLVEQPVCRAST
RIRITDNMFCAGYKPNEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIRKVIDQSGS
Download sequence
Identical sequences M3WSI8
XP_003993267.1.62641 ENSFCAP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]