SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003999940.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003999940.1.62641
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000759
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000353
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003999940.1.62641
Sequence length 264
Comment PREDICTED: somatomedin-B and thrombospondin type-1 domain-containing protein isoform X1 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MRTLWMALCALARLWPGTLAGCAEAGRCCPGRDAACFVRGWRLDRVYGTCFCDQACRLTG
DCCFDYARACPARPCIVGEWSPWSRCGDQCKPAARVRRRPVRQEPRNGGAPCPPLEERAG
CLDYSTPRGQDCGHSFVPAFITTSAFNKERTRQSTSPQWSTDTEDSGYCMEFKTESLTHH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences A0A2I2V191
XP_003999940.1.62641 ENSFCAP00000011623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]