SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004001167.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004001167.1.62641
Domain Number 1 Region: 98-186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000273
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004001167.1.62641
Sequence length 207
Comment PREDICTED: suppressor of IKBKE 1 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPEQYQEDAPD
IKDMSKFKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQVRKENSRDTASQAIK
Download sequence
Identical sequences M3WSN4
XP_004001167.1.62641 ENSFCAP00000017370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]