SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004002064.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004002064.1.66739
Domain Number 1 Region: 542-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000471
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 71-145,196-209,495-537
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 40-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000615
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004002064.1.66739
Sequence length 587
Comment PREDICTED: complement component C8 alpha chain [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MFAAAFFLLFLMTCQPGVTIQEKVNWRVSRAVESFTPTAVSCQLDNWAEWTDCFPCQDKK
YRYRSLLQPNKFGGTICSGNVWDQASCHSPTACLSQAQCGQDFQCKETGRCLKRHLVCNG
DQDCLDGSDEDDCEDFRIPENDCSQYDPIPGSERAALGYNILTQEETQNVYDARYYGGQC
ETVYNGEWRELQYDPACERLYYGDDDKYFRKPYNFLKYHFEALADTKFSSEKYNDVNDLL
TKVKNDNSVSKGLTVGVSSTRNPVMVTIGVSTSQDASFLKKLSKYNEKKYIFMRIFTKVQ
TAHFKMRRENIMLDEGMQQSLMELPEQYHYGIYAKFINDYGTHYITSGSMGGVYEYILVL
NREKMETAGITSTEIKRCFGVSLGIEYSEKIQTRGSLSLGPCEKSGDGKLTEDQKAMGME
DFISRVRGGSSGWGGGLTQESSIITYRSWGRSLKYNPAVIDFEIRPIHEILRHTNLGSLE
TKRQNLRRALDQYLMEFNACRCGPCFNNGEPILEGTSCKCLCPVGRQGLACEQMQSEGAK
ADGHWSCWSSWSACRSGTQERRRECNNPAPQNGGASCPGHRVQTQAC
Download sequence
Identical sequences W5PDR5
ENSOARP00000008579 XP_004002064.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]