SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004002209.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004002209.1.66739
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.01e-69
Family BAR domain 0.00044
Further Details:      
 
Domain Number 2 Region: 244-276,307-364
Classification Level Classification E-value
Superfamily SH3-domain 3.66e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004002209.1.66739
Sequence length 365
Comment PREDICTED: endophilin-B1 isoform X3 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSSYHSNNNQTSVAPVPSASSNVIGSSALTSTSSLVIASPSNLTD
LKECSGSRRARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITY
LELLN
Download sequence
Identical sequences W5PZR0
XP_004002209.1.66739 XP_011990012.1.54773 ENSOARP00000015946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]