SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004002705.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004002705.1.66739
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.73e-45
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004002705.1.66739
Sequence length 199
Comment PREDICTED: transgelin-2 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
VLCELINGLYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRYFSDNQLQEGKNVIGLQMGT
NRGASQAGMTGYGMPRQIL
Download sequence
Identical sequences Q5E9F5
ENSBTAP00000002674 ENSBTAP00000002674 NP_001013617.1.59421 NP_001013617.1.76553 XP_004002705.1.66739 XP_004002706.1.66739 XP_004002707.1.66739 XP_005892141.1.15283 XP_010845168.1.44457 XP_012013908.1.54773 XP_012013909.1.54773 XP_012013910.1.54773 XP_019843817.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]