SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004002919.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004002919.1.66739
Domain Number 1 Region: 295-454
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000337
Further Details:      
 
Domain Number 2 Region: 82-191
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-32
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 3 Region: 195-292
Classification Level Classification E-value
Superfamily LCCL domain 1.7e-23
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004002919.1.66739
Sequence length 779
Comment PREDICTED: discoidin, CUB and LCCL domain-containing protein 2 isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MASRAVVRAGHSPQRFLVRAAVAAPARAALSLSRSYPLPFRSNSSSTSFPRPLFLLLLLI
LLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPHTYPNSTVCEWEIRVKTGERVRIKFG
DFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKSNEITVLFMSGIHVS
GRGFLASYSVIEKQDLITCLDTASSFLEPEFSKYCPAGCLLPFAEISGAIPHGYRDSSPL
CMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTL
GMESGVIADAQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFATDEYQWLQVDLN
KEKKITGIVTTGSTMVEHNYYVSAYKILYSADGQRWTVYREPGVDQDKIFQGNKDYHQDV
RNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRSSNDLRNTT
TPPKIAKGRAPKFTQPLQPRSSNEFPTQTEQTTATPEIKNTTVTPNVTKDVALAAVLVPV
LVMVLTTLILILVCAWHWRNRKKKTKGTYDLPYWDRAGWWKGMKQFLPAKSVEHEETPVR
YSSSEVNHLSPREVTTMLQTDSAEYAQPLVGGIVGPLHQRSTFKPEEGKEAGYADLDPYS
SPVQEVYHAYAEPLPVTGPEYATPIVMDMSGHPSAAAGLPSTSTFKAAGNQPPTSVGTYN
TLLSRTDSCSSAQAQYDTPKGGKPGPSAPDELVYQVPQSTQEVSEAGKEGECDVFKEVL
Download sequence
Identical sequences W5Q8T4
ENSOARP00000019126 XP_004002919.1.66739 XP_012003719.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]