SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004009636.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004009636.1.66739
Domain Number 1 Region: 494-815
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.96e-108
Family PDEase 0.000000000015
Further Details:      
 
Domain Number 2 Region: 105-299
Classification Level Classification E-value
Superfamily GAF domain-like 1.98e-44
Family GAF domain 0.0000744
Further Details:      
 
Domain Number 3 Region: 285-489
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-37
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004009636.1.66739
Sequence length 833
Comment PREDICTED: cGMP-specific 3',5'-cyclic phosphodiesterase isoform X2 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MLPFGDKTREMVNAWFAERVHTIPVCKEGIKGHTESCSCPLQPSPRAESSVPGTPTRKIS
ASEFDRPLRPIVIKDSEGTVSFLSDSDKKEQMPLTSPRFDNDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAALGEPLNIKDAYEDPRFNAEVDQITGYRTQSILCMPIKNHREEVVGVA
QAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFE
EQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTRER
DANRINYMYAQYVKNTMEPLNIPDVSKDKRFPWTNENLGNINQQCIRSLLCTPIKNGKKN
KVIGVCQLVNKMEETTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVT
LEVLSYHASAAEEETRELQSLAAAVVPSAQTLRITDFSFSDFELSDLETALCTIRMFTDL
NLVQSFQMRHEVLCKWILSVKKNYRKSVAYHNWRHAFNTAQCMFAALKAGKIQKRLTDLE
ILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILS
GLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTA
CDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFID
AICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQEKTLINGESSQTKRN
Download sequence
Identical sequences W5Q3B7
XP_004009636.1.66739 ENSOARP00000017205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]