SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004010398.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004010398.1.66739
Domain Number 1 Region: 190-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000366
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Domain Number 2 Region: 397-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 136-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000109
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 33-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000017
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 5 Region: 328-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000956
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  XP_004010398.1.66739
Domain Number - Region: 354-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00353
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004010398.1.66739
Sequence length 712
Comment PREDICTED: low-density lipoprotein receptor-related protein 10 isoform X2 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MLPAILLLFLGGTVAHPDRIIFPNPACEDPPAVLLEAQGTLQRPVGRDSRSSPANCTWLI
LGRKEQTVTVRFQKLHLACGSERLTLRSPIQPQISLCEAPASPLQLPGGNVTITYSYVGA
RAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVPLFQRCDGVDACGDGSDEAGCSSDPFPD
LDLAPVLTPPCNHTLEDFYGVFSSLGYSHLASVSQPQSCRWLLDPRDGRRLAVRFTALDL
GYEDAVRVYDGAGPLETLRLLRSLTHFSNGKAVTVETLSGQATVDYRTVPWSTGRGFNAT
YHVRGYCLPWDRPCGLSSGLGASEGLGERCYSEAQRCDGSWDCADGTDEENCPSCPPGHY
PCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQ
PDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLS
RMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGST
SGARRRQRGRSMRRLVRRLRRWGLLPRTNPPARTPETRSQVTPSAAPPETLDGSTGPAHE
GGAVGGQDGEQAPPLPVKAPLPPSSISPAFPTVPEAPGPLPAVPLEPSLLSGVVQALRGR
LLPSLRPPGPTRVPPGPHTTVLSPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences W5QDQ0
ENSOARP00000020848 XP_004010398.1.66739 XP_011984713.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]