SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004013586.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004013586.1.66739
Domain Number 1 Region: 132-188
Classification Level Classification E-value
Superfamily F-box domain 0.00000343
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004013586.1.66739
Sequence length 376
Comment PREDICTED: transmembrane protein 183A isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MARGPGPLTRPRPDTVAMPKRGKRLKFRAQDACSGRVTVADYANSDPAVVRSGRVKKAVA
NAVQQEVKSLCGLEASQVPAVEALSGAGEPCDIIDSSGETDAQEESIHERTISRKKKSKR
HREDLNGTGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL
DASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF
WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMGGLQPPIQYEDVHTNPDQDCCLLQVTTL
NFIFIPIVMGMIFTLFTISVSTDMRHHRVRLVFQDYPVHGGQKLRSEQGVQVILDPVHSV
RLFDWWHPQYPSSLRA
Download sequence
Identical sequences W5NR90
ENSOARP00000000680 XP_004013586.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]