SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004013974.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004013974.1.66739
Domain Number 1 Region: 581-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-23
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Domain Number 2 Region: 453-531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.19e-18
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000183
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 396-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000256
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 334-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000577
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 6 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000389
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 522-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000786
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 8 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000011
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 152-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000446
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 10 Region: 37-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000157
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004013974.1.66739
Sequence length 661
Comment PREDICTED: coagulation factor XIII B chain isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MKSKGLALIIILIISGELHAEEKLCGFPSVENGRIAQYYYTFESYYFPMSINQNLSFSCL
VGYTTATGKREARTTCTAAGWSPEPQCFKKCPKPDLKNGYIFDSKLSYKIQENMRYRCAS
GYKSIAGKDEEVVQCLADGWSSQPTCRKEHETCLAPELHHGNYSTTQKTFKVKDRVRYEC
ASGYHTASGKRTEEAECHPYGWALTPQCTKLKCSSLRVIENGYFHPVKQTYEEGDVVQFF
CHKNYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPLNSNLQTYSTTYRHGETVRI
ECGLNFARQGAEEIRCENGKWTEPPKCVEDKQRTTCEAPPSVGNGAANPPSEVYHSGDKV
AYVCERGYHLRGPGEITCNHGRWTLPPECVENTENCNPPPGVINGAIIGELLASYPTGSS
VEYRCNEYYLLRGAKISHCEQGRWSSPPVCLEPCTVNVVDMHRNNVEMKWNYEGKILHGD
LIDFVCKQGYELSPSTPPSELSVQCNRGEVKYPSCIRKESKRACASPPAIKNGVIKSSAL
NTYENGSSVEYICFEHHFLQGARESYCLGGVWTTPPSCLEPCTLSFDTMENNNLLLKWNF
DNRPYIFHGEYVEFLCKRNTYIAGFPVSASESRVQCDRGQLNYPRCVQSERMLSYQEPLR
T
Download sequence
Identical sequences W5PXX3
XP_004013974.1.66739 ENSOARP00000015307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]