SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004014061.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004014061.1.66739
Domain Number 1 Region: 447-708
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-76
Family Eukaryotic proteases 0.0000000342
Further Details:      
 
Domain Number 2 Region: 51-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-30
Family Spermadhesin, CUB domain 0.00000129
Further Details:      
 
Domain Number 3 Region: 208-319
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-27
Family Spermadhesin, CUB domain 0.00000195
Further Details:      
 
Domain Number 4 Region: 390-459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0000335
Further Details:      
 
Domain Number 5 Region: 324-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000417
Family Complement control module/SCR domain 0.0000688
Further Details:      
 
Domain Number 6 Region: 159-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000355
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004014061.1.66739
Sequence length 710
Comment PREDICTED: mannan-binding lectin serine protease 2 isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MRWVEAPRTSLAGVRAESRPHCPCPAPPSGCRSFSGSAAASSGPQWPKPVFGRLASPGFP
DQYANNQERRWALTAPPGYRLRLYFTHFQLEPSYLCEYDFVKLSAGTKELATLCGSESTD
TERAPGNDTFYSPGSSLDVTFRSDYSNEKPFTGFEAFYSAEDIDECQVPPGEAPTCDHHC
HNHLGGFYCSCRVGYILHRNKRTCSALCSSQVFTARSGELSSPEYPQPYPKLSSCTYSIH
LEEGFHIILDFVESFDVEMHPETLCPYDSLKIRTDKAEYGPFCGKTLPRRIETKSNTVTI
TFTTDQSGDHMGWKVRYNSTAQPCPDPLAPPNGRISPVQAKYILKDHFSVFCETGYELLQ
GNLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGQVEYITAPAVTTYGAVVKYRC
NEFYAMTTDDGKYVCEADGFWTSSKREKSLPACEPVCGISTRTTEGRIYGGQNAKLGYFP
WQALLLGKTMAAGALLHDNWVLTAAHAVYDQREDAASLQIRMGALKRISPNYTQAWAEAI
FIHGSYIHDAGYDNDIALIKLKNKVVINSNIMPICLPRKEAESFMRTNDIGTASGWGLTQ
RGFLARNLKFVDIPVVDHQKCTAAYEKKSYPEGRVTDNMLCAGLQSGGKDSCRGDSGGAL
VFLDNETQKWFVGGIVSWGSTNCGEADQYGVYTKVINYIPWIKSIINSNF
Download sequence
Identical sequences W5P229
ENSOARP00000004478 XP_004014061.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]