SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004024541.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004024541.1.27298
Domain Number 1 Region: 26-174
Classification Level Classification E-value
Superfamily EF-hand 2.66e-42
Family Calmodulin-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004024541.1.27298
Sequence length 181
Comment PREDICTED: calmodulin-like protein 6 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELER
LMSLLGINPTKSELALMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFD
KEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLI
Q
Download sequence
Identical sequences G3R5B9
ENSGGOP00000010490 XP_004024541.1.27298 ENSGGOP00000010490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]