SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004024594.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004024594.1.27298
Domain Number 1 Region: 42-244
Classification Level Classification E-value
Superfamily L domain-like 2.01e-37
Family Ngr ectodomain-like 0.069
Further Details:      
 
Weak hits

Sequence:  XP_004024594.1.27298
Domain Number - Region: 445-493
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0214
Family B3/B4 domain of PheRS, PheT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004024594.1.27298
Sequence length 583
Comment PREDICTED: leucine-rich repeat-containing protein 47 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAAAAVSESWPELELAERERRRELLLTGPGLEERVRAAGGQLPPRLFTLPLLHYLEVSGC
GSLRAPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGL
GPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPL
LSELAAADNCLRELSPDIAHLASLKTLDLSNNQLSEIPAELADCPKLKEINFRGNKLRDK
RLEKMVSGCQTRSILEYLRVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQD
VGDAGRLLLRVLHVSENPAPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQT
KLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEA
EEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLF
LEVTSATSLQICKDVMDALILKMAEMNKYTLENKEEGSLSDTEADAVSGQLPDPRTNPSA
GKDGPSLLVVEQVRVVDLEGSLKVVYPSKADLATAPPHVTVVR
Download sequence
Identical sequences G3RHR5
XP_004024594.1.27298 ENSGGOP00000026520 ENSGGOP00000015192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]