SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004024694.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004024694.1.27298
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-75
Family F-box associated region, FBA 0.00000179
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 3.01e-16
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004024694.1.27298
Sequence length 255
Comment PREDICTED: F-box only protein 44 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences A0A024R4F9 A0A2K5HZX1 A0A2K5LZN4 A0A2K5X279 A0A2K6A6K7 A0A2K6PTZ3 G3QI63 H9EM80 K7BUP0 Q9H4M3
ENSP00000251547 ENSP00000365961 9544.ENSMMUP00000003017 9606.ENSP00000251547 ENSMMUP00000003017 ENSP00000251547 ENSP00000365961 ENSMMUP00000003017 NP_001014765.1.87134 NP_001014765.1.92137 NP_001247805.1.72884 NP_001291720.1.87134 NP_001291720.1.92137 NP_149438.2.87134 NP_149438.2.92137 XP_001138245.2.37143 XP_003822126.1.60992 XP_003949342.2.37143 XP_004024694.1.27298 XP_004024696.1.27298 XP_005544846.1.63531 XP_006711108.1.92137 XP_007978750.1.81039 XP_007978751.1.81039 XP_007978752.1.81039 XP_007978754.1.81039 XP_008973847.1.60992 XP_008973848.1.60992 XP_008973849.1.60992 XP_008973850.1.60992 XP_009446490.2.37143 XP_009446493.2.37143 XP_010351811.1.97406 XP_010351812.1.97406 XP_010351813.1.97406 XP_011791203.1.43180 XP_011851987.1.47321 XP_011904742.1.92194 XP_011904743.1.92194 XP_011904744.1.92194 XP_011904745.1.92194 XP_011904746.1.92194 XP_015007330.1.72884 XP_015007392.1.72884 XP_015298134.1.63531 XP_015298138.1.63531 XP_016809500.1.37143 XP_016858332.1.92137 XP_018866640.1.27298 XP_018866652.1.27298 XP_018866658.1.27298 XP_018866666.1.27298 XP_514390.3.37143 gi|34878735|ref|NP_149438.2| gi|62388868|ref|NP_001014765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]