SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004025312.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004025312.1.27298
Domain Number 1 Region: 86-299
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.76e-82
Family Fibrinogen C-terminal domain-like 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004025312.1.27298
Sequence length 299
Comment PREDICTED: ficolin-3 isoform X3 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPG
PQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF
CDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELR
VELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDS
SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Download sequence
Identical sequences G3QCU8 O75636
ENSP00000270879 gi|27754776|ref|NP_003656.2| ENSP00000270879 ENSP00000270879 NP_003656.2.87134 NP_003656.2.92137 XP_004025312.1.27298 ENSGGOP00000000046 9606.ENSP00000270879 ENSGGOP00000000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]