SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004026324.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004026324.1.27298
Domain Number 1 Region: 31-57,174-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.15e-61
Family G proteins 0.0000000601
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.35e-41
Family Transducin (alpha subunit), insertion domain 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004026324.1.27298
Sequence length 354
Comment PREDICTED: guanine nucleotide-binding protein G(t) subunit alpha-2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGSGASAEDKELAKRSKELEKKLQEDADREAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMP
PELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences G3RBX2
XP_004026324.1.27298 ENSGGOP00000012988 ENSGGOP00000012988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]