SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004027047.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004027047.1.27298
Domain Number 1 Region: 88-200
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-21
Family SH2 domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004027047.1.27298
Sequence length 399
Comment PREDICTED: SH2 domain-containing protein 2A [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCRNLGYTAASPQAPEAASNTGNAERAE
EVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRRVRPPLSVTHREAERLLE
PKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLGDGRHVVLGEDSAHARLQDLLRHY
TAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQ
KEGAGEKETSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFY
AMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
Download sequence
Identical sequences G3RCR9
ENSGGOP00000013303 XP_004027047.1.27298 ENSGGOP00000013303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]