SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004027964.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004027964.1.27298
Domain Number 1 Region: 875-985
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000367
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004027964.1.27298
Sequence length 1124
Comment PREDICTED: sodium/hydrogen exchanger 11 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSSYFWAQNESNRPDLLCGQPADYLVEEKHFTTLVCFIVVLGGLLKMCLKNSEVIVLTIL
SLSGFVIGHMAYNSVEVHQIVYPLLRTSSFSLYSYFSPLIIFMVALDLEFYTLKKMFWQV
LLTGLISFSTASIIIGYVVIKFNKDSWDLQSCLLFSITLGIIDPLRSVNSLKTIGISKIY
IDLIRGESLIICSIASIFFGNFRGNRIHFSIFRDLHVGIELSYDILGSIIFGYWCAKIIQ
CILADVFSNMLTNIILCFSMVYMTFYIVEFLGMSGTLALAAVGLNLDSLTFKPKIELVIT
KFLRIFSSVYEHLIYAFFGIVIGCGELSHYEFYTIPFIFILFTTVNLVRLLTILLVSPIL
MHSNYEYNWRWGVVITWSGIKGVFNLLWAPDVYNLAERKVEVPQMFILYVQVISLLTMGI
NSYVMTQSARKLDLCVLSLPRQMILQNATQHIQEIVQNTITLFKTEKILTNVNWTLVEDK
TRIEYIPFSHVSHNDMKTESTTDEALMEEARLHVAAVQMSSFEKQRNNGILEIEAARILI
GAAKCYYSIQGKFMSIYDVSTYMRTRSWLIKFKNVLTFLEYCIEKIHFIPPESNTFLTFI
FHIVFSEEFEYTGQIINLIYIYPMIIHLWPMARGLNVSALISINYYFMFLYVLESTLKII
ILKRKYFQQCWNTLEFFILVIGIIDIFCVYFVKLRPDNLALIELTVIMGYLRIIRFLPLF
KIIVPILTRIADVQIKKRLSLMYSITKGYIKSQEDAKLLIKQIAVCESIYQKLCEILETN
KQDAVKELVLMEHEGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHEVIEINKVL
LKKLKALNNFPKAIPPPTPDIYLHNIIWLEGKDVLIDFFKERAKLACFDSGDTICKAGEM
PQGIYLIISGMAILHSFSPTFGTESSQRRDRRSRVMFTEFCTTGDIIGELSCLLKREIEY
TVICETSLQACFISLEDLYEGFDAFWPSLEYKIWLKLALSTAYQYFESSLIDEDLRFQNC
VMFNQAYVETLSSYSDMTIDNMTMKFVIIVYGSVIDTKTEEPYFAPCIIPTTCEQVQGTS
DLSKLLIIQASELTRRNSNTNVMASVNMVFEPPGKNINGRQKMS
Download sequence
Identical sequences G3R4F4
ENSGGOP00000010155 XP_004027964.1.27298 ENSGGOP00000010155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]