SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004028355.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004028355.1.27298
Domain Number 1 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-19
Family Complement control module/SCR domain 0.0000225
Further Details:      
 
Domain Number 2 Region: 223-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.37e-16
Family Complement control module/SCR domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 98-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000109
Family Complement control module/SCR domain 0.0000313
Further Details:      
 
Domain Number 4 Region: 36-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000216
Family Complement control module/SCR domain 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004028355.1.27298
Sequence length 381
Comment PREDICTED: complement decay-accelerating factor isoform X7 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEEGFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTIVEYECRPGYMREPSLSTKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPSGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
DHYGYRQSITYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGNGTTSGTTRLLS
GHTCFTLTGLLGMLVTMGLPT
Download sequence
Identical sequences ENSGGOP00000020728 XP_004028355.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]