SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004028366.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004028366.1.27298
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-16
Family Complement control module/SCR domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.78e-16
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 4 Region: 35-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000124
Family Complement control module/SCR domain 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004028366.1.27298
Sequence length 399
Comment PREDICTED: membrane cofactor protein isoform X8 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEPPGRRECPFPSWRFPGLLLAALVLLLSSFSDACEEPPTFEAMELIGKPKPYYEIGERV
DYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAIIANGTYEFG
YQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWDPPVPKCLKVLPPSSTKPPALSHS
VSTSSTTKSPASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIAVIVIAIVVGVAV
ICVVPYRYLQRRKKKGKADGGAEYATYQTKSTTPAEQRG
Download sequence
Identical sequences G3QD59
ENSGGOP00000000168 XP_004028366.1.27298 ENSGGOP00000018748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]