SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004029484.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004029484.1.27298
Domain Number 1 Region: 78-247
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-52
Family Dual specificity phosphatase-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004029484.1.27298
Sequence length 377
Comment PREDICTED: RNA/RNP complex-1-interacting phosphatase [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MRNSETLERGVGGCRVSSGLGSYPGIEGAGLALLAGLALGGRLLGTHMSQWHHPRSGWGR
RRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSP
LDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHA
VNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQ
NYIEDLQNGPIRKNWNSSVPRSSGFEDSAHLMQPVHNKPVKQGPRHNLHQIQGHSAPRHL
HTQTQNLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWY
PYSYSRLSYPACWEWTQ
Download sequence
Identical sequences ENSGGOP00000009880 ENSGGOP00000009880 XP_004029484.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]