SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004037964.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004037964.1.27298
Domain Number 1 Region: 100-217
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.53e-50
Family Latexin-like 0.000000365
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.06e-36
Family Latexin-like 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004037964.1.27298
Sequence length 222
Comment PREDICTED: latexin [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEE
IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEDDNTFYQRLKSMKEPLEAQ
NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Download sequence
Identical sequences G3QKQ9
ENSGGOP00000003040 XP_004037964.1.27298 ENSGGOP00000003040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]