SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004038853.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004038853.1.27298
Domain Number 1 Region: 221-410
Classification Level Classification E-value
Superfamily Serum albumin-like 7.26e-57
Family Serum albumin-like 0.00000671
Further Details:      
 
Domain Number 2 Region: 414-597
Classification Level Classification E-value
Superfamily Serum albumin-like 6.84e-53
Family Serum albumin-like 0.0000124
Further Details:      
 
Domain Number 3 Region: 33-219
Classification Level Classification E-value
Superfamily Serum albumin-like 2.06e-50
Family Serum albumin-like 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004038853.1.27298
Sequence length 599
Comment PREDICTED: afamin isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MKLLKLTGFIFFLFFLPESLTLPTQPRDVENFNSTQKFIEENIEYITIIAFAQYVQEATF
EEMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKYNFSHCCSKVDAQ
RRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLT
VAAHFEEVAKSCCEEQNKVNCFQTRAIPVTQYLKAFSSYQKHVCGALLKFGTKVVHFIYI
AILSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIK
ECCEKKILERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
RHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQ
NLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFG
ELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQN
EELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN
Download sequence
Identical sequences G3RCD3
ENSGGOP00000013158 ENSGGOP00000013158 XP_004038853.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]