SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004039139.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004039139.1.27298
Domain Number 1 Region: 513-663
Classification Level Classification E-value
Superfamily EF-hand 1.75e-50
Family Osteonectin 0.00000203
Further Details:      
 
Domain Number 2 Region: 458-510
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.00054
Further Details:      
 
Domain Number 3 Region: 431-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000044
Family Follistatin (FS) module N-terminal domain, FS-N 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004039139.1.27298
Sequence length 664
Comment PREDICTED: SPARC-like protein 1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MKTGLFFLCLLGTAAAIPTNARLLADHSKPTAETVAPDNTAIPSLRAEDEENEKETAVST
EDDSHRKAEKSSVLKSKEESHGQSAEQGKSSSQELGLKDQEDSDGDLSVNLEYAPTEGTL
DIKEDMSEPQEKKLSENTDFLAPDVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQGLRDQGNQEQDPNISNGEEEEEKEPDEVGTHNDNQERKTELPREHANSKQEEDNTQS
DDILEESDQPTQVSKMQEDEFDLSNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETDEKTVSEVLLMEPTDDGNTMSRNHGADDDGGDDGDDGGNDGPRHSASDD
YFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTSEPGEHQEAKKAENSSNEEETS
SEGNMRVHGVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYA
SSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYE
ANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDE
NLLF
Download sequence
Identical sequences G3RHD3
ENSGGOP00000015051 ENSGGOP00000015051 XP_004039139.1.27298 XP_018880780.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]