SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004040282.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004040282.1.27298
Domain Number 1 Region: 449-591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-22
Family MAM domain 0.0008
Further Details:      
 
Domain Number 2 Region: 186-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000463
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000011
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  XP_004040282.1.27298
Domain Number - Region: 53-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004040282.1.27298
Sequence length 595
Comment PREDICTED: nephronectin isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDEHIPAPLDQGSEQPLFQPLDHQATSLPSRDL
NECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIR
CQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGKY
QCHDIDECSLGQYQCSSFARCYNIRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVP
KGNGTILKGDRGHNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPTPIPTPPP
PPPLPTELRTPLPPTTPERPTTRLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQ
PSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWISEKDNDLHWEPIRDPAGG
QYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAA
LWGRNGGHGWRQTQITLRGADIKSVIFKGEKRRGHTGEIGLDDVSLKKGHCSEER
Download sequence
Identical sequences G3S615
XP_004040282.1.27298 ENSGGOP00000023522 ENSGGOP00000013378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]