SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004040582.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004040582.1.27298
Domain Number 1 Region: 172-425
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.26e-93
Family Fibrinogen C-terminal domain-like 0.0000000000655
Further Details:      
 
Domain Number 2 Region: 30-167
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 1.24e-61
Family Fibrinogen coiled-coil and central regions 0.00000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004040582.1.27298
Sequence length 437
Comment PREDICTED: fibrinogen gamma chain isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATMKSRKMLEEIM
KYEALILTHDSSIRYLQEIYNSNNQKIVNLKEKVSQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQAGDV
Download sequence
Identical sequences G3R8D4
ENSGGOP00000011638 XP_004040582.1.27298 ENSGGOP00000011638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]