SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004040637.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004040637.1.27298
Domain Number 1 Region: 288-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-57
Family SPRY domain 0.0000218
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000275
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004040637.1.27298
Sequence length 471
Comment PREDICTED: tripartite motif-containing protein 60 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLNVSWKDLDDTFPCPVCRFCF
PYKSFRRNPQLRNLTEIAKQLWIRRSKRKRRKENAVCEKHNQFLTLFCVKDLEILCTQCS
FSTKHQKHYICPIKKAASYHREILEGSLEPLKNNIERVEKVIILQGSKSVELKKKVEYKR
EEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGK
SVQSNLELLTHAKSMHHKYQNLKCPELFSFSLTKYGFSLPPQYSGLDRIIKPFQVDVILD
LDTAHPQLLVSEDRRAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRHYWEVEVGNKP
KWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLD
YELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSEPLKICSVSDSER
Download sequence
Identical sequences G3R284
ENSGGOP00000009327 XP_004040637.1.27298 ENSGGOP00000009327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]