SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004040680.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004040680.1.27298
Domain Number 1 Region: 79-164
Classification Level Classification E-value
Superfamily HMG-box 2.36e-31
Family HMG-box 0.00000617
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 3.4e-27
Family HMG-box 0.00000728
Further Details:      
 
Weak hits

Sequence:  XP_004040680.1.27298
Domain Number - Region: 182-207
Classification Level Classification E-value
Superfamily ARM repeat 0.0547
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004040680.1.27298
Sequence length 208
Comment PREDICTED: high mobility group protein B2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
SKKKNEPEDEEEEEEEDEDEEEEDEDEE
Download sequence
Identical sequences G1R4I5 G3RII6 Q5U071
ENSNLEP00000008107 ENSGGOP00000015491 ENSGGOP00000015491 ENSNLEP00000008107 XP_003258025.1.23891 XP_004040680.1.27298 XP_004040681.1.27298 XP_012363650.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]