SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004041500.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004041500.1.27298
Domain Number 1 Region: 48-195
Classification Level Classification E-value
Superfamily EF-hand 3.23e-33
Family Calmodulin-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004041500.1.27298
Sequence length 197
Comment PREDICTED: myosin light chain 4 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAF
SLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL
QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQED
ANGCINYEAFVKHIMSG
Download sequence
Identical sequences G3R2N7 P12829
gi|4557038|ref|NP_002467.1| gi|50845428|ref|NP_001002841.1| ENSP00000347055 ENSP00000377096 ENSP00000461570 ENSP00000347055 ENSP00000377096 ENSP00000442375 ENSP00000461570 ENSGGOP00000009496 ENSP00000347055 9606.ENSP00000347055 ENSGGOP00000009496 NP_001002841.1.87134 NP_001002841.1.92137 NP_002467.1.87134 NP_002467.1.92137 XP_004041498.1.27298 XP_004041500.1.27298 XP_005257448.1.92137 XP_018883666.1.27298 XP_018883667.1.27298 XP_018883668.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]