SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004041724.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004041724.1.27298
Domain Number 1 Region: 321-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-24
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 91-123
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000115
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 203-319
Classification Level Classification E-value
Superfamily Prefoldin 0.0000418
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004041724.1.27298
Sequence length 467
Comment PREDICTED: keratin, type I cuticular Ha6 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MATQTCTPTFSIGSIKGLCGTAGGISRVSSIHSVGSCRVPSLAGAAGYISSARSGLSGLG
SCLPGSYLSSGCHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAE
LESCIREWYESQIPHICPDYQSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRT
KYETELSLRQLVEADINGLRRILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRC
QLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQTQHSMRNSLESTLAETEASYSSQLAQMQCLISNVEA
QLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRRLLEGEDCKLPLPPCATACKPVIRVP
SVPPVPCVPAVPCTPAPQVGTQIRTITEEIRDGKVISSREHMQSRPL
Download sequence
Identical sequences XP_004041724.1.27298 ENSGGOP00000016468 ENSGGOP00000016468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]