SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004042019.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004042019.1.27298
Domain Number 1 Region: 59-119
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000311
Family ComEA-like 0.042
Further Details:      
 
Domain Number 2 Region: 170-354
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000311
Family Mitochondrial resolvase ydc2 catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004042019.1.27298
Sequence length 360
Comment PREDICTED: transcription elongation factor, mitochondrial [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSGSVLFTAGERWRCFLTPSRSSLFWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENA
LDKLFSSEQQASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPL
FKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRI
AWAHLDRKLTVLDWQQSDRWSLMRGIYSSSVYLEEISSIISKMPKADFYVLEKTGLSIQN
SSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNAVGKHFELMIGDSRTSGKELV
KQFLSDSILKADPRVFFPSDKIVHYRQMFLSTELQRVEELYDSLLQAIAFYELAVFDSQP
Download sequence
Identical sequences G3RXU1 H2QCL7
ENSPTRP00000015302 ENSGGOP00000020628 9598.ENSPTRP00000015302 XP_003812022.1.60992 XP_004042019.1.27298 XP_511389.2.37143 ENSGGOP00000020628 ENSPTRP00000015302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]