SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004042490.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004042490.1.27298
Domain Number 1 Region: 107-291
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 6.15e-51
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004042490.1.27298
Sequence length 298
Comment PREDICTED: isochorismatase domain-containing protein 1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAAAEPAVLALPNSGAGGAGAPSGTVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYGD
QIDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCC
DMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVL
PKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSR
SMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences G1RP92 G3RAI7 H2R5E6 Q96CN7
9598.ENSPTRP00000048075 9606.ENSP00000173527 ENSGGOP00000012460 ENSPTRP00000048075 ENSP00000421273 ENSP00000173527 ENSNLEP00000015056 ENSP00000173527 ENSPTRP00000048075 ENSNLEP00000015056 ENSGGOP00000012460 gi|103471987|ref|NP_057132.2| NP_057132.2.87134 NP_057132.2.92137 XP_001160234.1.37143 XP_003259964.1.23891 XP_004042490.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]