SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004043811.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004043811.1.27298
Domain Number 1 Region: 27-108
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.11e-27
Family MHC antigen-recognition domain 0.00000591
Further Details:      
 
Domain Number 2 Region: 110-206
Classification Level Classification E-value
Superfamily Immunoglobulin 3.56e-24
Family C1 set domains (antibody constant domain-like) 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004043811.1.27298
Sequence length 254
Comment PREDICTED: HLA class II histocompatibility antigen, DR alpha chain [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAVSGVPVLGFFIIAVLMRTQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GVRKSNAAERRGPL
Download sequence
Identical sequences G3R317
ENSGGOP00000009633 XP_004043811.1.27298 ENSGGOP00000009633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]