SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004043906.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004043906.1.27298
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily UBA-like 0.00000816
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004043906.1.27298
Sequence length 232
Comment PREDICTED: uncharacterized protein C6orf106 homolog isoform X3 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSDVIWVILSVEVGGLLG
VTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPA
PDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
Download sequence
Identical sequences A0A2I2Z4A9 A0A2K5LI43 A0A2K5UWB9 A0A2K5ZCG7 A0A2K6CF31 A0A2K6QT80 K7B5L9
ENSP00000363138 ENSP00000363138 gi|46094086|ref|NP_073595.2| NP_073595.2.87134 NP_073595.2.92137 XP_003808590.1.60992 XP_004043906.1.27298 XP_005553310.1.63531 XP_007971076.1.81039 XP_010356363.1.97406 XP_011727468.1.29376 XP_011841926.1.47321 XP_011931296.1.92194 XP_016810768.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]