SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004045216.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004045216.1.27298
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000334
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004045216.1.27298
Sequence length 448
Comment PREDICTED: nucleoporin-like protein 2 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAICQFFLQGRCRFGDRCWNEHPGARGVGVGRQQPQQQPSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKAGFGLSENPFASLSPDEQKDEKKFLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR
LINQWRNRVNELKSLNISTKVALKCLWKIYTHLSPKIYGPDCGKFIIFLSDVKDGVNQAA
PAFGFGSSQAATFMSPGFPVNNSSSDNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAA
STSSGISTSAPAFGFGKPEVTSAASFSFKSPAASSFGSPGFSGLPTSLATGPVRAPVAPA
FGGGSSVAGFGSPGSHSHTAFSKPSSDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTV
EELEQFQSKKFTLGKIPLKPPPLELLNI
Download sequence
Identical sequences XP_004045216.1.27298 ENSGGOP00000001022 ENSGGOP00000024831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]