SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004046011.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004046011.1.27298
Domain Number 1 Region: 295-584
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.22e-26
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 2 Region: 16-123
Classification Level Classification E-value
Superfamily L domain-like 7.14e-18
Family Internalin LRR domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004046011.1.27298
Sequence length 647
Comment PREDICTED: leucine-rich repeat and WD repeat-containing protein 1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGPLSARLLMQRGRPKSDRLGKIRSLDLSGLELLSEHLDPKLLCRLTQLQELDLSNNHLE
TLPDNLGLSHLRVLRCANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLR
KVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRDVRYG
PESLSEFTQWRVRMISEELVAASRTQVQKANSPEKPPEAGAAHKPRARLAALKRPDDVPL
SLSPSKRACASPSAQVEGGPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAF
EPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTALMVVTQAGHKK
RWSVLAAAGLRGLVRLLHVRAGFCCGVIRAHKKAIATLCFSPAHETHLFTASYDKRIILW
DIGVPNQDYEFQASQLLTLDTTSIPLRLCPVASCPDARLLAGCEGGCCCWDVRLDQPQKR
RVCEVEFVFSEGSEASGRRVDGLAFVNEDIVASKGSGLGTICLWSWRQTWGGRGSQSTVA
VVVLARLQWSSTELAYFSLSACPDKGIVLCGDEEGNVWLYDISNILKQPPLLPAALQAPT
QILKWPQPWALGQVVTKTMVNTVVANASFTYLTALTDSNIVAIWGRM
Download sequence
Identical sequences A0A2I2YVC5
ENSGGOP00000025398 ENSGGOP00000025398 XP_004046011.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]