SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004047588.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004047588.1.27298
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily L domain-like 4.08e-30
Family U2A'-like 0.023
Further Details:      
 
Weak hits

Sequence:  XP_004047588.1.27298
Domain Number - Region: 316-384
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000233
Family Nuclear movement domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004047588.1.27298
Sequence length 466
Comment PREDICTED: protein tilB homolog isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKTLQHNIHLKELFL
MGNPCASFDHYREFVVATLPQLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKR
AKLKEEAQRKHQEEDKNEDKRSNAGFDGRWYTDINATLSSLESKDRLQAPDIEEHNTKKL
DNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKNQEKLSEKKKKVKPPRTLIAEDGKALN
VNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGRPFQLVLPAEVKP
DSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI
Download sequence
Identical sequences A0A2I2Z7D5
XP_004047588.1.27298 ENSGGOP00000000795 ENSGGOP00000000795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]