SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004048312.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004048312.1.27298
Domain Number 1 Region: 74-359
Classification Level Classification E-value
Superfamily L domain-like 1.25e-56
Family Ngr ectodomain-like 0.000000138
Further Details:      
 
Weak hits

Sequence:  XP_004048312.1.27298
Domain Number - Region: 7-55
Classification Level Classification E-value
Superfamily ARM repeat 0.00964
Family Armadillo repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004048312.1.27298
Sequence length 381
Comment PREDICTED: asporin [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MKEYVLLLFLALCSAKPFFSPSHTALKNMMLKDMEDTDDDDDDDDDDDDDDDEDNSLFPT
REPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKE
NDFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIH
ENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGL
PPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENN
KLKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEM
QPATFRCVLSRMSVQLGNFGM
Download sequence
Identical sequences G3SJH4
XP_004048312.1.27298 ENSGGOP00000001938 ENSGGOP00000028264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]