SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004049821.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004049821.1.27298
Domain Number 1 Region: 129-150,181-365
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.32e-76
Family Fumble-like 0.0000000166
Further Details:      
 
Domain Number 2 Region: 11-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.12e-46
Family Fumble-like 0.0000000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004049821.1.27298
Sequence length 373
Comment PREDICTED: pantothenate kinase 1 isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MKLINGKKQTFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGK
TGIRDVHLELKNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFK
FEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLD
NPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAK
GDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNN
IGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAV
GALLELFKMTDDK
Download sequence
Identical sequences A0A2J8PEC6 A0A2J8WQK2 A0A2K5DGR4 G3RXB0
ENSP00000345118 9600.ENSPPYP00000002860 gi|23510402|ref|NP_683879.1| ENSP00000345118 NP_683879.1.87134 NP_683879.1.92137 XP_003312808.1.37143 XP_004049821.1.27298 XP_008948923.1.60992 XP_012310172.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]