SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004050139.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004050139.1.27298
Domain Number 1 Region: 165-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.72e-45
Family Dual specificity phosphatase-like 0.0000196
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.91e-24
Family Cell cycle control phosphatase, catalytic domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004050139.1.27298
Sequence length 384
Comment PREDICTED: dual specificity protein phosphatase 5 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MKVTSLDGRQLRKMLRKETAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSEYPECCVDVKPISQEKIESERNLISQCGKPVVNVSYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTTHLHYKWIPVEDSHTADISS
HFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTNQFRLKEAFDYIKQRRSMV
SPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASV
LAPVPTHSTVSELSRSPVATATSC
Download sequence
Identical sequences G3QJK4
ENSGGOP00000002600 XP_004050139.1.27298 ENSGGOP00000002600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]