SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004050817.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004050817.1.27298
Domain Number 1 Region: 108-170
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.2e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004050817.1.27298
Sequence length 320
Comment PREDICTED: myoblast determination protein 1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP
GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEPAAPSEGESSGDPTQS
PDAAPQCPAGANPNLIYQVL
Download sequence
Identical sequences G3S3Y5
ENSGGOP00000008036 XP_004050817.1.27298 ENSGGOP00000022786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]