SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004051676.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004051676.1.27298
Domain Number 1 Region: 307-468
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-41
Family Dual specificity phosphatase-like 0.00088
Further Details:      
 
Domain Number 2 Region: 272-319
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000183
Family DEK C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004051676.1.27298
Sequence length 659
Comment PREDICTED: protein phosphatase Slingshot homolog 3 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MALVTVSRSPPGSGASTPVGPWDRAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEA
SSEPTEEAPSEEELRGDQMDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAA
RPPRLRYLLVVSTREGEGLSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGG
FSVTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWASHYQERLNSEQ
SCLNEWTTMADLESLRPPSAEPGRSSEQEQMEQAIRAELWKVLDASDLESVTSKEIRQAL
ELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILN
MAREIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFIEAARAQGTHVLVHCKMGVSRS
AATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKV
GGVSPEERPAPEVSTPFPPLPPEPGGGGEEKVVGMEESQAAPKEKPGPRPRINLRGIMRS
ISLLEPSLELESTSETSDMPEVFSSHESSHEEPLQPFPQLARTKGGQQVDRGPQPALKSR
QSVVTLQGSAVVANRTQAFQEQEQGQGQGQGEPCISSTPRFRKVVRQASVHDSGEEGEA
Download sequence
Identical sequences G3R6S4
ENSGGOP00000011041 ENSGGOP00000011041 XP_004051676.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]