SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004052027.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004052027.1.27298
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily Cupredoxins 2.68e-59
Family Multidomain cupredoxins 0.000002
Further Details:      
 
Domain Number 2 Region: 377-572
Classification Level Classification E-value
Superfamily Cupredoxins 1.33e-52
Family Multidomain cupredoxins 0.00000366
Further Details:      
 
Domain Number 3 Region: 730-914
Classification Level Classification E-value
Superfamily Cupredoxins 5.21e-49
Family Multidomain cupredoxins 0.00000409
Further Details:      
 
Domain Number 4 Region: 222-366
Classification Level Classification E-value
Superfamily Cupredoxins 7.18e-49
Family Multidomain cupredoxins 0.00000856
Further Details:      
 
Domain Number 5 Region: 921-1067
Classification Level Classification E-value
Superfamily Cupredoxins 2.06e-44
Family Multidomain cupredoxins 0.00000472
Further Details:      
 
Domain Number 6 Region: 575-719
Classification Level Classification E-value
Superfamily Cupredoxins 6.88e-42
Family Multidomain cupredoxins 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004052027.1.27298
Sequence length 1159
Comment PREDICTED: hephaestin-like protein 1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MPRKQPAGCIFLLTFLGLSGLVGTVTRTYYIGIVEEYWNYVPQGKNVITGKSFTEDKLAT
LFLERGPNRIGSIYKKAVYRRFTDGTYSIEIPKPPWLGFLGPILRAEVGDVIIIHLKNFA
SRPYSLHPHGVFYNKDSEGALYPDATSGRNKNDDMVPPGKNYTYVWPVREEYAPTPADAN
CLTWVYHSHIDAPKDICSGLIGPLLVCKEGILNRYSGTRNDVDQEFVIMFTLVDENQSWY
LNENIKHFCTDPDSVDKKDAVFQRSNKMHALNGYLFGNFPEPDMCVGESVSWHLFGMGNE
IDIHSIYFYGNTFISRGHRTDVVNLFPATFLTTEMIAENPGKWMITCQVSDHLQAGMLGQ
YNVDNCKSDIFYPKMKGQQRRYFIAAEKILWDYAPQGYNKFSGLPLNASGSDSDLYFTQG
DNRIGGKYWKVRYTEFVDATFTKRKRLSAEEAHLGILGPVIKAEVGDTLLVTFANKADKV
YSILPHGVIYDKASDAAPNLDGFVKPGAHVKPGETFTYKWTVPESVSPTAGDPPCLTYLY
FSAVDPIKDTSSGLVGPLLVCKKGVLNADGTQKGIDKEFYLLFTVFDENLSRYFDENIQK
FIWHPFSIDKEDKEFVKSNRMHAVNGYMYGNQPGLNMCKRDRVSWHLIGLGTDTDMHGIV
FQGNTIHLRGTHRDSLALFPHMATTAFMQPDHAGIFRVFCATMPHLSRGMGQIYEVSSCD
NRDPSEQRYGMIRTFYIAAEEVEWDYAPNKNWEFEKQHVDARGERHGDIFMNRTENWIGS
QYKKVVYREYTDGEFVEIKARPPREEHLELLGPMIHAEVGNTVLIIFKNKASRPYSISAQ
GVEEMDSGKQFQVPMTKPGEVKTYRWNIPKRSGPGPSDPNCIPWVYYSTVNFVKDTYSGL
MGPLITCRKGVLNEKGRRSDVDYEFALLFLVFNENESWYLDDNIKKYLNKDPRDFKRTED
FEESNRMHAINGKIFGNLHGLIMNEDTMTNWYLLGIGSEVDIHTIHYHAESFLFKIDKSY
REDVYDLFPGTFQTIELFADHPGTWLLHCHVSDHIHAGMETTYTVLRNIDNRIPYSTTSP
GVASHPATVPSNERPGKEQLYVFGKNLGPTGAKAALVILFIIGLLLLITTVILSLRLCSA
MKQTDYQQVQSCALPTDAL
Download sequence
Identical sequences G3SBH1
XP_004052027.1.27298 ENSGGOP00000025447 ENSGGOP00000025447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]