SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004053831.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004053831.1.27298
Domain Number 1 Region: 82-528
Classification Level Classification E-value
Superfamily HAD-like 2.88e-147
Family 5' nucleotidase-like 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004053831.1.27298
Sequence length 548
Comment PREDICTED: 5'-nucleotidase domain-containing protein 3 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTMAAAAVVARGARARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWER
YREAKRSTEELVPSIMSNLLNPDAIFSNNEMSLSDIEIYGFDYDYTLVFYSKHLHTLIFN
AARDLLINEHRYPAEIRKYEYNPNFAIRGLHYDVQRAVLMKIDAFHYIQLGTVYRGLSVV
PDEEVIEMYEGSHVPLEQMSDFYGKSSHGNTMKQFMDIFSLPEMTLLSCVNEYFLKNNID
YEPVHLYKDVKDSIRDVHIKGIMYRAIEADIEKYICYAEQTRAVLAKLADHGKKMFLITN
SPSSFVDKGMSYIVGKDWRDLFDVVIVQAEKPNFFNDKRRPFRKMNEKGVLLWDKIHKLQ
KGQIYKQGNLYEFLKLTGWRGSRVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELKIM
NTEQYIQTMTWLQTLTGLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLF
RTDQNPTYFLRRLSRFADIYMASLSCLLNYDVSHTFYPRRTPLQHELPAWSERPPTFGTP
LLQEAQAK
Download sequence
Identical sequences G3RDC7
XP_004053831.1.27298 ENSGGOP00000013527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]