SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004054030.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004054030.1.27298
Domain Number 1 Region: 174-270
Classification Level Classification E-value
Superfamily AMPKBI-like 1.32e-34
Family AMPKBI-like 0.00000831
Further Details:      
 
Domain Number 2 Region: 78-161
Classification Level Classification E-value
Superfamily E set domains 1.68e-27
Family AMPK-beta glycogen binding domain-like 0.00000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004054030.1.27298
Sequence length 270
Comment PREDICTED: 5'-AMP-activated protein kinase subunit beta-1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences A0A024RBN1 A0A096N4C2 A0A0D9S4F8 A0A2K5EEE9 A0A2K5J1Y9 A0A2K5LCA5 A0A2K5PTW9 A0A2K6CPW7 A0A2K6L9N5 F7BMG6 F7GTI4 G2HGR1 G3RB90 G7PIT4 Q9Y478
ENSGGOP00000012730 NP_001233530.1.37143 NP_001253044.1.72884 NP_006244.2.87134 NP_006244.2.92137 XP_003832451.1.60992 XP_004054030.1.27298 XP_005253966.1.92137 XP_005572434.1.63531 XP_008003095.1.81039 XP_008956042.1.60992 XP_011762203.1.29376 XP_011784112.1.43180 XP_011784113.1.43180 XP_011930490.1.92194 XP_012324402.1.9421 XP_012324403.1.9421 XP_017365698.1.71028 XP_017734552.1.44346 XP_017831902.1.60252 XP_018894373.1.27298 ENSCJAP00000016725 ENSP00000229328 ENSGGOP00000012730 ENSPTRP00000009369 ENSMMUP00000026113 GO.34692 HR12 ENSP00000229328 ENSP00000441369 ENSCJAP00000016725 ENSCJAP00000048298 ENSPANP00000007235 gi|19923359|ref|NP_006244.2| ENSP00000229328 ENSP00000441369 ENSMMUP00000026113 4zhx_B 4zhx_D 5ezv_B 5ezv_D 6b1u_B 6b1u_D ENSPTRP00000009369 9544.ENSMMUP00000026113 9598.ENSPTRP00000009369 9606.ENSP00000229328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]