SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004054610.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004054610.1.27298
Domain Number 1 Region: 166-266
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.7e-33
Family GS domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 24-109
Classification Level Classification E-value
Superfamily TPR-like 2.79e-20
Family Tetratricopeptide repeat (TPR) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004054610.1.27298
Sequence length 365
Comment PREDICTED: protein SGT1 homolog isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGN
YCVAVADAKKSLELNPNNSTAMLRKGICEYHGKNYAAALETFTEGQKLDIETGFHRVGQA
GLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTE
SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST
KIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPHTRNWDKLVGEIREEEKN
EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDM
EWKKY
Download sequence
Identical sequences G3QV95
ENSGGOP00000006659 ENSGGOP00000017342 XP_004054610.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]