SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004057932.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004057932.1.27298
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.31e-31
Family Cytochrome b5 0.0000248
Further Details:      
 
Weak hits

Sequence:  XP_004057932.1.27298
Domain Number - Region: 116-143
Classification Level Classification E-value
Superfamily Aquaporin-like 0.00235
Family Aquaporin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004057932.1.27298
Sequence length 150
Comment PREDICTED: cytochrome b5 type B [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCK
SCWAYWILPIIGAVLLGFLYRYYTSESKSS
Download sequence
Identical sequences G3RGC9
XP_004057932.1.27298 ENSGGOP00000014673 ENSGGOP00000014673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]